Recombinant Human HESX1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HESX1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human HESX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HESX1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HESX1 Protein

  • CPHD5
  • hAnf
  • HESX homeobox 1
  • homeobox expressed in ES cells 1
  • Homeobox protein ANF
  • MGC138294
  • Rathke pouch homeobox
  • RPXES cell expressed 1

Background

This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-44054
Species: Hu
Applications: PEP-ELISA
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008820-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HESX1 Partial Recombinant Protein (H00008820-Q01) (0)

There are no publications for HESX1 Partial Recombinant Protein (H00008820-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HESX1 Partial Recombinant Protein (H00008820-Q01) (0)

There are no reviews for HESX1 Partial Recombinant Protein (H00008820-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HESX1 Partial Recombinant Protein (H00008820-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HESX1 Products

Bioinformatics Tool for HESX1 Partial Recombinant Protein (H00008820-Q01)

Discover related pathways, diseases and genes to HESX1 Partial Recombinant Protein (H00008820-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HESX1 Partial Recombinant Protein (H00008820-Q01)

Discover more about diseases related to HESX1 Partial Recombinant Protein (H00008820-Q01).
 

Pathways for HESX1 Partial Recombinant Protein (H00008820-Q01)

View related products by pathway.

Blogs on HESX1

There are no specific blogs for HESX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HESX1 Antibody
NBP1-89090
POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HESX1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HESX1