HES5 Antibody (4S4U7) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 12-142 of human HES5 (Q5TA89). SPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HES5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Immunohistochemistry 1:100-1:500
- Immunohistochemistry-Paraffin 1:100-1:500
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HES5 Antibody (4S4U7)
Background
GFP, also known as green fluorescent protein, is a protein produced by the jellyfish (Aequorea Victoria) that emits bioluminescence in the green zone of the visible spectrum. GFP has become a useful and ubiquitous tool for making chimeric proteins, where it functions as a fluorescent protein tag. It has been expressed in most known cell types and is used as a noninvasive fluorescent marker in living cells and organisms. This protein enables a wide range of applications where it has functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Recombinant GFP protein was expressed in E.coli and purified by using conventional chromatography.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ChIP, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, WB
Species: Ca, Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Mu, Rt
Applications: WB, ELISA, IHC
Publications for HES5 Antibody (NBP3-16880) (0)
There are no publications for HES5 Antibody (NBP3-16880).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HES5 Antibody (NBP3-16880) (0)
There are no reviews for HES5 Antibody (NBP3-16880).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HES5 Antibody (NBP3-16880) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HES5 Products
Research Areas for HES5 Antibody (NBP3-16880)
Find related products by research area.
|
Blogs on HES5