HERC5 Antibody - BSA Free

Immunohistochemistry-Paraffin: HERC5 Antibody [NBP1-91985] Staining of human testis shows strong cytoplasmic positivity in the spermatogonia.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HERC5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HERC5 Antibody - BSA Free (NBP1-91985) is a polyclonal antibody validated for use in IHC. Anti-HERC5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HERC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HERC5 Protein (NBP1-91985PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HERC5 Antibody - BSA Free

• CEB1E3 ISG15--protein ligase HERC5
• CEBP1
• cyclin-E binding protein 1
• Cyclin-E-binding protein 1
• EC 6.3.2
• EC 6.3.2.-
• HECT domain and RCC1-like domain-containing protein 5
• hect domain and RLD 5
• HECT E3 ubiquitin ligase
• probable E3 ubiquitin-protein ligase HERC5

Background

The HERC5 gene encodes for a 1,024 amino acid long, 116kDA E3 1SG15-protein ligase HERC5 protein near a cluster of HERC family genes located on chromosome 4. The protein coded for by the HERC5 gene localizes to the cytoplasm and perinuclear region and works as an interferon-induced E3 protein ligase. In doing so, it controlls ISGylation of protein targets. The HERC5 gene has been researched regarding influenza, malaria, teratoma, angelman syndrom, and carcinoma. The HERC5 gene interacts in interferon signaling, cytokine signaling in the immune system, and negative regulation of RIG-I/MDA4 signaling with interactions in NME2, CCNA2, ERCC2, PITX2, and NME1-NME2 genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HERC5 Antibody (NBP1-91985)(1)

Publication using NBP1-91985

• Suceveanu A, Micu I, Baltatescu G, et al. Overexpression of Survivin‑1, TAG‑72 and HERC5 in patients diagnosed with hepatocellular carcinoma in the Black Sea coast geographical area Experimental and Therapeutic Medicine 2021-01-26 [PMID: 33603891] (IHC-P, Human)

Bioinformatics

• Gene Symbol: HERC5