HERC5 Antibody

Images

 
Western Blot: HERC5 Antibody [NBP1-58102] - hek293 cell lysate at 1:1000.
Immunocytochemistry/ Immunofluorescence: HERC5 Antibody [NBP1-58102] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes; Primary ...read more
Western Blot: HERC5 Antibody [NBP1-58102] - Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HERC5 Antibody Summary

Immunogen
Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the middle region of HERC5. Peptide sequence FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HERC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against HERC5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HERC5 Antibody

  • CEB1E3 ISG15--protein ligase HERC5
  • CEBP1
  • cyclin-E binding protein 1
  • Cyclin-E-binding protein 1
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT domain and RCC1-like domain-containing protein 5
  • hect domain and RLD 5
  • HECT E3 ubiquitin ligase
  • probable E3 ubiquitin-protein ligase HERC5

Background

HERC5 is a member of the HERC family of ubiquitin ligases.It contains a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulates expression of HERC5 protein in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
A-306
Species: Hu
Applications: WB, IHC
NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for HERC5 Antibody (NBP1-58102) (0)

There are no publications for HERC5 Antibody (NBP1-58102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC5 Antibody (NBP1-58102) (0)

There are no reviews for HERC5 Antibody (NBP1-58102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HERC5 Antibody (NBP1-58102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HERC5 Products

Bioinformatics Tool for HERC5 Antibody (NBP1-58102)

Discover related pathways, diseases and genes to HERC5 Antibody (NBP1-58102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC5 Antibody (NBP1-58102)

Discover more about diseases related to HERC5 Antibody (NBP1-58102).
 

Pathways for HERC5 Antibody (NBP1-58102)

View related products by pathway.

PTMs for HERC5 Antibody (NBP1-58102)

Learn more about PTMs related to HERC5 Antibody (NBP1-58102).
 

Research Areas for HERC5 Antibody (NBP1-58102)

Find related products by research area.

Blogs on HERC5

There are no specific blogs for HERC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC5
Uniprot