Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody

Immunocytochemistry/Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP1-90913] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Discontinued

Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HS6ST2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody

• EC-1
• heparan sulfate 6-O-sulfotransferase 2
• HS6ST2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HS6ST2