Home » HEM1 » HEM1 Proteins » HEM1 Recombinant Protein Antigen

HEM1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HEM1 Protein (NBP2-13643PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HEM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCKAP1L.

Source: E.coli

Amino Acid Sequence: VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCKAP1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13643.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HEM1 Recombinant Protein Antigen

  • Hematopoietic protein 1HEM1Membrane-associated protein HEM-1
  • NCK-associated protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

WASF1/WAVE1
Antibody
AF5514
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, A172 human glioblastoma cell line, and 293T human embryonic kidney cell line, and mouse brain tissue. PVDF membrane was probed with 1 µg/mL of Human/Mouse WASF1/WAVE1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5514) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WASF1/WAVE1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu
Applications: WB
WASP Antibody
(7B10E4)
NBP2-52587
Western Blot: WASP Antibody (7B10E4) [NBP2-52587] - Analysis using WAS mAb against human WAS (AA: 57-170) recombinant protein. (Expected MW is 39 kDa)
Immunohistochemistry-Paraffin: WASP Antibody (7B10E4) [NBP2-52587] - Analysis of paraffin-embedded colon cancer tissues using WAS mouse mAb with DAB staining.
Flow Cytometry: WASP Antibody (7B10E4) [NBP2-52587] - Analysis of Hela cells using WAS mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, ICC/IF
SQLE Antibody
NBP2-32001
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human colon shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
(2 Publications)
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
WASF2 Antibody
NBP2-37912
Immunocytochemistry/Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AKT1 [p Ser473]
Antibody (104A282)
NB100-56749
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - Total protein from mouse 3T3 cells treated with and without PDGF (50 ng/mL) for the indicated times was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-AKT1 (NBP2-01725) and 2 ug/mL pS473 AKT1 in 1% BSA in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the detection of phosphorylated AKT1 in response to PDGF treatment compared to total AKT1 protein.
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - WB of phospho AKT using phospho AKT antibody at 2 ug/mL against untreated (lane 1) and PDGF treated (lane 2) NIH-3T3 lysate. HRP conjugated secondary antibody and ECL substrate solution were used for this test. Image using the Azide and BSA Free form of this antibody.
Immunohistochemistry-Paraffin: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - IHC analysis of an FFPE human breast carcinoma tissue section using 1:250 dilution of phospho Ser473 AKT1 antibody (clone 104A282) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of phosphor-AKT (Ser-473) in the cancer cells as well as the stromal cells. Staining was performed by Histowiz.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NAP1L1 Antibody
NBP1-81162
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
HAP1 Antibody (1B6)
NB110-74569
Western Blot: HAP1 Antibody (1B6) [NB110-74569] - Analysis of HAP1 using Lane 1: mouse brain lysate and Lane 2: human brain lysate.
Immunohistochemistry: HAP1 Antibody (1B6) [NB110-74569] - Staining of rat hypothalamus.
Flow Cytometry: HAP1 Antibody (1B6) [NB110-74569] - Intracellular flow cytometric staining of 1 x 10^6 MCF-7 cells using HAP1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot: Triosephosphate isomerase Antibody [NBP1-31470] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Triosephosphate isomerase antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Triosephosphate isomerase Antibody [NBP1-31470] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Triosephosphate isomerase stained by Triosephosphate isomerase antibody [C2C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10um.
Immunohistochemistry-Paraffin: Triosephosphate isomerase Antibody [NBP1-31470] - Paraffin-embedded SNU-16 xenograft, using antibody at 1:100 dilution.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
HMBS Antibody
NBP1-87329
Western Blot: HMBS Antibody [NBP1-87329] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HMBS Antibody [NBP1-87329] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: HMBS Antibody [NBP1-87329] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Cyclin I Antibody
NBP2-47123
Western Blot: Cyclin I Antibody [NBP2-47123] - Sample (30 ug of whole cell lysate) A: HCT116 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: Cyclin I Antibody [NBP2-47123] - Analysis of paraffin-embedded RF48 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(18 Reviews)
(292 Publications)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Recombinant Human
CYP27B1 Protein
H00001594-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Kv11.1 Antibody
NBP2-80513
Kv11.1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Knockdown Validated: APE Antibody (13B8E5C2) [NB100-116] - Repression of p21 by APE1 in p53-null cells and effect of ectopic p53 in this repression. Representative Western analysis of p53, APE1, p21 and alpha-Tubulin levels in the same HCT116p53null cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).
(3 Reviews)
(90 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of COS-7 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunohistochemistry-Paraffin: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis showing positive staining in the cytoplasm and membrane of Mouse liver tissue (right) compared with a negative control in the absence of primary antibody (left).
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of HT29 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescentred phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
CYC1 Antibody
NBP1-86872
Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in human cell lines PC-3 and SK-MEL-30. Corresponding CYC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/Immunofluorescence: CYC1 Antibody [NBP1-86872] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human skeletal muscle shows moderate granular positivity in cytoplasm in myocytes.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HEM1 Protein (NBP2-13643PEP) (0)

There are no publications for HEM1 Protein (NBP2-13643PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEM1 Protein (NBP2-13643PEP) (0)

There are no reviews for HEM1 Protein (NBP2-13643PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEM1 Protein (NBP2-13643PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional HEM1 Products

Array NBP2-13643PEP

Bioinformatics Tool for HEM1 Protein (NBP2-13643PEP)

Discover related pathways, diseases and genes to HEM1 Protein (NBP2-13643PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEM1 Protein (NBP2-13643PEP)

Discover more about diseases related to HEM1 Protein (NBP2-13643PEP).
 

Pathways for HEM1 Protein (NBP2-13643PEP)

View related products by pathway.

Blogs on HEM1

There are no specific blogs for HEM1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
IL-2 [Unconjugated]
202-IL-010
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
APE Antibody (13B8E5C2)
NB100-116

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEM1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCKAP1L
COVID-19 update