HECTD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HECTD4 Antibody [NBP2-30719] - Staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HECTD4 Antibody [NBP2-30719] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HECTD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KETVHIPGARCLYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLGTGWPKDLVKVEGDTVTFSFEMRSGREHNTPDKAMWGFACTVR
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HECTD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HECTD4 Protein (NBP2-30719PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP2-30719 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HECTD4 Antibody

  • C12orf51
  • chromosome 12 open reading frame 51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
AF5236
Species: Mu
Applications: WB
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP2-22288
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-91440
Species: Hu
Applications: WB
NBP1-92581
Species: Hu
Applications: IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-56787
Species: Hu
Applications: IHC, IHC-P, WB
H00023316-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
NB300-578
Species: Am, Ca, Ch, Fe, Ha, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88637
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NBP1-58950
Species: Hu
Applications: IHC, IHC-P, WB
MAB6237
Species: Hu
Applications: IHC, WB
3500-RS/CF
Species: Hu
Applications: BA
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13599
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HECTD4 Antibody (NBP2-30719) (0)

There are no publications for HECTD4 Antibody (NBP2-30719).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for HECTD4 Antibody (NBP2-30719) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-30719:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Verified Customer
IHC-Fr Mouse 06/30/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult heart
SpeciesMouse
Lotr67405

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HECTD4 Antibody (NBP2-30719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HECTD4 Products

Bioinformatics Tool for HECTD4 Antibody (NBP2-30719)

Discover related pathways, diseases and genes to HECTD4 Antibody (NBP2-30719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HECTD4

There are no specific blogs for HECTD4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Verified Customer
06/30/2018
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol HECTD4
Uniprot