HECTD4 Antibody

Images

 
Immunohistochemistry-Paraffin: HECTD4 Antibody [NBP2-30697] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HECTD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ACLLNVPIESLRLRFALLQSLNTTLETFFLPLVELRQTPMYTHSIAALLKEAKGLIFYDTKVTVMNRVLNATVQRTADHAAPEITLDPLEIVGGEIRASENSY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HECTD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HECTD4 Protein (NBP2-30697PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HECTD4 Antibody

  • C12orf51
  • chromosome 12 open reading frame 51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
AF5236
Species: Mu
Applications: WB
NBP2-37401
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56562
Species: Hu
Applications: ICC/IF
NBP1-92581
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-84232
Species: Hu
Applications: WB, IHC, IHC-P
H00023316-M03
Species: Hu
Applications: WB, ELISA
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6237
Species: Hu
Applications: WB, IHC
NBP2-45637
Species: Hu
Applications: IHC
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13599
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30697
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for HECTD4 Antibody (NBP2-30697) (0)

There are no publications for HECTD4 Antibody (NBP2-30697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HECTD4 Antibody (NBP2-30697) (0)

There are no reviews for HECTD4 Antibody (NBP2-30697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HECTD4 Antibody (NBP2-30697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HECTD4 Products

Bioinformatics Tool for HECTD4 Antibody (NBP2-30697)

Discover related pathways, diseases and genes to HECTD4 Antibody (NBP2-30697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HECTD4

There are no specific blogs for HECTD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HECTD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HECTD4
Uniprot