HDC2/PHC2 Antibody - Azide and BSA Free

Western Blot: HDC2/PHC2 Antibody [NBP3-03609] - Analysis of extracts of various cell lines, using HDC2/PHC2 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HDC2/PHC2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HDC2/PHC2 Antibody - Azide and BSA Free (NBP3-03609) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-323 of human HDC2/PHC2 (NP_004418.2). HFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HDC2/PHC2 Antibody - Azide and BSA Free

• early development regulator 2 (homolog of polyhomeotic 2)
• Early development regulatory protein 2
• EDR2
• HPH2
• MGC163502
• PH2
• polyhomeotic 2
• polyhomeotic homolog 2 (Drosophila)
• polyhomeotic-like 2 (Drosophila)
• polyhomeotic-like 2
• polyhomeotic-like protein 2

Background

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PHC2