HDAC1 Antibody (5C11)

Images

 
Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml
Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in PC-12 (Cat # L012V1).
Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Hela S3 NE (Cat # L013V3).
Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11. Lane 1: HDAC1 transfected lysatE (55.1 KDa). Lane 2: ...read more
ELISA: HDAC1 Antibody (5C11) [H00003065-M14] - Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.
Proximity Ligation Assay: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, PLA
Clone
5C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HDAC1 Antibody (5C11) Summary

Immunogen
HDAC1 (AAH00301, 1 a.a. - 482 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Specificity
HDAC1 (5C11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HDAC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00003065-M14.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HDAC1 Antibody (5C11)

  • EC 3.5.1.98
  • GON-10
  • HD1DKFZp686H12203
  • histone deacetylase 1
  • reduced potassium dependency, yeast homolog-like 1
  • RPD3L1RPD3

Background

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HDAC1 Antibody (H00003065-M14)(1)

Reviews for HDAC1 Antibody (H00003065-M14) (0)

There are no reviews for HDAC1 Antibody (H00003065-M14). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HDAC1 Antibody (H00003065-M14) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDAC1 Products

Bioinformatics Tool for HDAC1 Antibody (H00003065-M14)

Discover related pathways, diseases and genes to HDAC1 Antibody (H00003065-M14). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC1 Antibody (H00003065-M14)

Discover more about diseases related to HDAC1 Antibody (H00003065-M14).
 

Pathways for HDAC1 Antibody (H00003065-M14)

View related products by pathway.

PTMs for HDAC1 Antibody (H00003065-M14)

Learn more about PTMs related to HDAC1 Antibody (H00003065-M14).
 

Research Areas for HDAC1 Antibody (H00003065-M14)

Find related products by research area.

Blogs on HDAC1.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC1 Antibody (5C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC1
Entrez
OMIM
Uniprot