HCC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HCC1 Antibody [NBP1-88200] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: HCC1 Antibody [NBP1-88200] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: HCC1 Antibody [NBP1-88200] - Staining of human cervix, uterine shows moderate nuclear positivity in keratinocytes.

Immunohistochemistry-Paraffin: HCC1 Antibody [NBP1-88200] - Staining of human colon shows strong nuclear positivity in glandular cells.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RBM39 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HCC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM39
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HCC1 Protein (NBP1-88200PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22711543)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HCC1 Antibody - BSA Free

• CAPER alpha
• CAPER
• CAPERalpha
• CC1.3
• coactivator of activating protein-1 and estrogen receptors
• DKFZp781C0423
• FLJ44170
• fSAP59
• functional spliceosome-associated protein 59
• HCC1
• HCC1CAPERalpha
• Hepatocellular carcinoma protein 1
• RBM39
• RNA binding motif protein 39
• RNA-binding motif protein 39
• RNA-binding protein 39
• RNA-binding region-containing protein 2
• RNPC2
• RRM) containing 2
• splicing factor CC1.3
• Splicing factor HCC1

Background

HCC1 is encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HCC1 Antibody (NBP1-88200)(1)

Publication using NBP1-88200

• Sillars-Hardebol AH, Carvalho B, Belien JA et al. CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression. Cell Oncol (Dordr) 2012-08-01 [PMID: 22711543]

Bioinformatics

• Gene Symbol: RBM39