HCA59 Antibody


Western Blot: HCA59 Antibody [NBP1-83170] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HCA59 Antibody [NBP1-83170] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170] - Staining in human bone marrow and pancreas tissues using anti-C9orf78 antibody. Corresponding C9orf78 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HCA59 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Specificity of human, mouse, rat HCA59 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
HCA59 Lysate (NBP2-65065)
Control Peptide
HCA59 Protein (NBP1-83170PEP)
Read Publication using NBP1-83170.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HCA59 Antibody

  • bA409K20.3
  • C9orf78
  • chromosome 9 open reading frame 78
  • HCA59
  • Hepatocellular carcinoma-associated antigen 59
  • HSPC220


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF

Publications for HCA59 Antibody (NBP1-83170)(1)

Reviews for HCA59 Antibody (NBP1-83170) (0)

There are no reviews for HCA59 Antibody (NBP1-83170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HCA59 Antibody (NBP1-83170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HCA59 Products

Bioinformatics Tool for HCA59 Antibody (NBP1-83170)

Discover related pathways, diseases and genes to HCA59 Antibody (NBP1-83170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCA59 Antibody (NBP1-83170)

Discover more about diseases related to HCA59 Antibody (NBP1-83170).

Pathways for HCA59 Antibody (NBP1-83170)

View related products by pathway.

Blogs on HCA59

There are no specific blogs for HCA59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HCA59 Antibody and receive a gift card or discount.


Gene Symbol C9ORF78