HCA59 Antibody

Images

 
Western Blot: HCA59 Antibody [NBP1-83170] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HCA59 Antibody [NBP1-83170] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HCA59 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9ORF78
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HCA59 Protein (NBP1-83170PEP)
Publications
Read Publication using NBP1-83170.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HCA59 Antibody

  • bA409K20.3
  • C9orf78
  • chromosome 9 open reading frame 78
  • HCA59
  • Hepatocellular carcinoma-associated antigen 59
  • HSPC220

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1260
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-55339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02486
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-45545
Species: Hu
Applications: WB, IHC
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB100-55324
Species: Hu
Applications: WB, IP, PLA
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-46409
Species: Hu
Applications: WB, IHC
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051270-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP

Publications for HCA59 Antibody (NBP1-83170)(1)

Reviews for HCA59 Antibody (NBP1-83170) (0)

There are no reviews for HCA59 Antibody (NBP1-83170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HCA59 Antibody (NBP1-83170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCA59 Products

Bioinformatics Tool for HCA59 Antibody (NBP1-83170)

Discover related pathways, diseases and genes to HCA59 Antibody (NBP1-83170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCA59 Antibody (NBP1-83170)

Discover more about diseases related to HCA59 Antibody (NBP1-83170).
 

Pathways for HCA59 Antibody (NBP1-83170)

View related products by pathway.

Blogs on HCA59

There are no specific blogs for HCA59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCA59 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9ORF78