![Western Blot: HCA59 Antibody [NBP1-83168] - Analysis using Anti-C9orf78 antibody NBP1-83168 (A) shows similar pattern to independent antibody NBP1-83170 (B).](http://images.novusbio.com/fullsize/HCA59-Antibody-Western-Blot-NBP1-83168-img0015.jpg "Western Blot: HCA59 Antibody [NBP1-83168] - Analysis using Anti-C9orf78 antibody NBP1-83168 (A) shows similar pattern to independent antibody NBP1-83170 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HCA59 Antibody - BSA Free (NBP1-83168) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HCA59 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C9ORF78 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83168 | Applications | Species |
|---|---|---|
| Fagerberg L, Oksvold P, Skogs M et al. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). J Proteome Res 2013-06-07 [PMID: 23276153] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C9ORF78 |
![Immunocytochemistry/Immunofluorescence: HCA59 Antibody [NBP1-83168] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83168-img0008.jpg "Immunocytochemistry/Immunofluorescence: HCA59 Antibody [NBP1-83168] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0025.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: HCA59 Antibody [NBP1-83168] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/HCA59-Antibody-Western-Blot-NBP1-83168-img0007.jpg "Western Blot: HCA59 Antibody [NBP1-83168] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: HCA59 Antibody [NBP1-83168] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-C9orf78 antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/HCA59-Antibody-Western-Blot-NBP1-83168-img0012.jpg "Western Blot: HCA59 Antibody [NBP1-83168] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-C9orf78 antibody. Remaining relative intensity is presented.")
![Western Blot: HCA59 Antibody [NBP1-83168] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/HCA59-Antibody-Western-Blot-NBP1-83168-img0013.jpg "Western Blot: HCA59 Antibody [NBP1-83168] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0002.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0009.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0010.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human testis.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0016.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human testis.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human kidney.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0017.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human lymph node.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0018.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Analysis in human bone marrow and pancreas tissues. Corresponding HCA59 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0019.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Analysis in human bone marrow and pancreas tissues. Corresponding HCA59 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human bone marrow, fallopian tube, lymph node and testis using Anti-HCA59 antibody NBP1-83168 (A) shows similar protein distribution across tissues to independent antibody NBP1-83170 (B).](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0021.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human bone marrow, fallopian tube, lymph node and testis using Anti-HCA59 antibody NBP1-83168 (A) shows similar protein distribution across tissues to independent antibody NBP1-83170 (B).")
![Immunohistochemistry: HCA59 Antibody [NBP1-83168] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-NBP1-83168-img0022.jpg "Immunohistochemistry: HCA59 Antibody [NBP1-83168] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0023.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/HCA59-Antibody-Immunohistochemistry-Paraffin-NBP1-83168-img0024.jpg "Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83168] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.")
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")