HAP40 Antibody - Azide and BSA Free

Western Blot: HAP40 Antibody [NBP3-02964] - Analysis of extracts of various cell lines, using HAP40 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Product Discontinued

HAP40 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human HAP40 (NP_036283.2). ALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYSW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: F8A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HAP40 Antibody - Azide and BSA Free

• coagulation factor VIII-associated (intronic transcript) 1
• coagulation factor VIII-associated 1
• cpG island protein
• DXS522E
• F8A
• factor VIII associated protein
• factor VIII intron 22 protein
• HAP40
• huntingtin-associated protein 40

Background

HAP40 is a 40 kDa Huntington-associated protein. It is likely to contribute to the function of normal Huntington and is a candidate for involvement in the aberrant nuclear localization of mutant Huntington, found in degenerating neurons of Huntingtons disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for HAP40 Antibody (NBP3-02964)(1)

Publication using NBP3-02964

• Xu S, Li G, Ye X et al. HAP40 is a conserved central regulator of Huntingtin and a potential modulator of Huntington's disease pathogenesis PLoS genetics Jul 1 2022 [PMID: 35853002]

Bioinformatics

• Gene Symbol: F8A1