H2AFV Antibody - Azide and BSA Free

Western Blot: H2AFV Antibody [NBP3-04426] - Analysis of extracts of various cell lines, using H2AFV antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunohistochemistry-Paraffin: H2AFV Antibody [NBP3-04426] - Immunohistochemistry of paraffin-embedded Rat testis using H2AFV Rabbit pAb (NBP3-04426) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: H2AFV Antibody [NBP3-04426] - Analysis of U-2 OS cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: H2AFV Antibody - Azide and BSA Free [H2AFV] - Immunofluorescence analysis of L929 cells using H2AFV Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: H2AFV Antibody - Azide and BSA Free [H2AFV] - Immunofluorescence analysis of C6 cells using H2AFV Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

H2AFV Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit H2AFV Antibody - Azide and BSA Free (NBP3-04426) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFV (NP_036544.1). MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: H2AZ2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for H2AFV Antibody - Azide and BSA Free

• FLJ26479
• H2A histone family, member V
• H2A.F/Z
• H2AV
• histone H2A.F/Z
• histone H2A.V
• MGC10170
• MGC10831
• MGC1947
• purine-rich binding element protein B

Background

H2AFV is 128 amino acids long, weighs approximately 13.5 kDa, and the gene codes for a variant component that is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. H2AFV has three shorter isoforms that are 114, 90, and 102 amino acids long, weighing 12, 9, and 11 kDa respectively. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, malaria, ataxia telangiectasia, intrahepatic cholangiocarcinoma, pharyngitis, and immunodeficiency. H2AFV has also been shown to have interactions with MORF4L1, MRGBP, PAX9, CAMSAP2, and ATG4C in pathways such as the systemic lupus erythematosus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: H2AZ2