GYG2 Antibody

Images

 
Western Blot: GYG2 Antibody [H00008908-D01P] - Analysis of GYG2 expression in human liver.
Western Blot: GYG2 Antibody [H00008908-D01P] - Analysis of GYG2 expression in A-431.
Western Blot: GYG2 Antibody [H00008908-D01P] - Analysis of GYG2 expression in transfected 293T cell line by GYG2 polyclonal antibody.Lane 1: GYG2 transfected lysate(52.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GYG2 Antibody Summary

Immunogen
GYG2 (AAH23152.1, 1 a.a. - 470 a.a.) full-length human protein. MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Specificity
GYG2 - glycogenin 2,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GYG2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GYG2 Antibody

  • glycogenin 2
  • glycogenin-2
  • GN-2GN2EC 2.4.1.186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002992-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-49382
Species: Hu
Applications: IHC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP1-79776
Species: Hu, Rt
Applications: WB
NBP2-07799
Species: Hu
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu

Publications for GYG2 Antibody (H00008908-D01P) (0)

There are no publications for GYG2 Antibody (H00008908-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GYG2 Antibody (H00008908-D01P) (0)

There are no reviews for GYG2 Antibody (H00008908-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GYG2 Antibody (H00008908-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GYG2 Products

Bioinformatics Tool for GYG2 Antibody (H00008908-D01P)

Discover related pathways, diseases and genes to GYG2 Antibody (H00008908-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GYG2 Antibody (H00008908-D01P)

Discover more about diseases related to GYG2 Antibody (H00008908-D01P).
 

Pathways for GYG2 Antibody (H00008908-D01P)

View related products by pathway.

PTMs for GYG2 Antibody (H00008908-D01P)

Learn more about PTMs related to GYG2 Antibody (H00008908-D01P).

Blogs on GYG2

There are no specific blogs for GYG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GYG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GYG2
Entrez
Uniprot