Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysatE (37.5 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).
ELISA: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.
GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Specificity
GYG1 - glycogenin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GYG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 28683291).
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Glycogenin 1 Antibody (3B5)
EC 2.4.1.186
glycogenin 1
glycogenin
glycogenin-1
GN1
GN-1
GSD15
GYG
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Glycogenin 1 Antibody (H00002992-M07) (0)
There are no reviews for Glycogenin 1 Antibody (H00002992-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Bioinformatics Tool for Glycogenin 1 Antibody (H00002992-M07)
Discover related pathways, diseases and genes to Glycogenin 1 Antibody (H00002992-M07). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Glycogenin 1 Antibody (H00002992-M07)
Discover more about diseases related to Glycogenin 1 Antibody (H00002992-M07).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Glycogenin 1 Antibody (3B5) and receive a gift card or discount.
PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation
Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally.