Glycogenin 1 Antibody (3B5)

Images

 
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).
Immunohistochemistry-Paraffin: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysatE (37.5 KDa). Lane 2: ...read more
ELISA: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glycogenin 1 Antibody (3B5) Summary

Immunogen
GYG1 (NP_004121, 1 a.a. - 73 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Specificity
GYG1 - glycogenin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GYG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00002992-M07.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28683291).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogenin 1 Antibody (3B5)

  • EC 2.4.1.186
  • glycogenin 1
  • glycogenin
  • glycogenin-1
  • GN1
  • GN-1
  • GSD15
  • GYG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-33194
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-74102
Species: Mu, ChHa
Applications: WB
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Glycogenin 1 Antibody (H00002992-M07)(8)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00002992-M07 Applications Species
Testoni G, Duran J, Garcia-Rocha M et al. Lack of Glycogenin Causes Glycogen Accumulation and Muscle Function Impairment Cell Metab. 2017 Jul 05 [PMID: 28683291] (Mouse) Mouse
Hedberg-Oldfors C, Glamuzina E, Ruygrok P et al. Cardiomyopathy as presenting sign of glycogenin-1 deficiency-report of three cases and review of the literature. J Inherit Metab Dis 2016 Oct 7 [PMID: 27718144]
Tasca G, Fattori F, Monforte M et al. Start codon mutation of GYG1 causing late-onset polyglucosan body myopathy with nemaline rods. J Neurol 2016 Aug 20 [PMID: 27544502]
Malfatti E, Nilsson J, Hedberg-Oldfors C et al. A new muscle glycogen storage disease associated with Glycogenin-1 deficiency. Ann Neurol. 2014 Oct 31 [PMID: 25272951]
Nilsson J, Halim A, Larsson E et al. LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences. Biochim Biophys Acta. 2013 Nov 14 [PMID: 24239874]
Taylor KM, Meyers E, Phipps M et al. Dysregulation of multiple facets of glycogen metabolism in a murine model of Pompe disease. PLoS One. 2013 [PMID: 23457523]
Nilsson J, Halim A, Moslemi AR et al. Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation. Biochim Biophys Acta. 2011 Dec 09 [PMID: 22198226]
Shinozaki S, Choi CS, Shimizu N et al. Liver-specific iNOS expression is sufficient to cause hepatic insulin resistance and mild hyperglycemia in mice. J Biol Chem. 2011 Aug 16. [PMID: 21846719]

Reviews for Glycogenin 1 Antibody (H00002992-M07) (0)

There are no reviews for Glycogenin 1 Antibody (H00002992-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycogenin 1 Antibody (H00002992-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycogenin 1 Products

Bioinformatics Tool for Glycogenin 1 Antibody (H00002992-M07)

Discover related pathways, diseases and genes to Glycogenin 1 Antibody (H00002992-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycogenin 1 Antibody (H00002992-M07)

Discover more about diseases related to Glycogenin 1 Antibody (H00002992-M07).
 

Pathways for Glycogenin 1 Antibody (H00002992-M07)

View related products by pathway.

Blogs on Glycogenin 1

There are no specific blogs for Glycogenin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycogenin 1 Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GYG1
Entrez
OMIM
Uniprot