Glycogenin 1 Antibody (3B5)

Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysatE (37.5 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml

Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).

Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).

ELISA: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 3B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Glycogenin 1 Antibody (3B5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
• Specificity: GYG1 - glycogenin 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GYG1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28683291).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogenin 1 Antibody (3B5)

• EC 2.4.1.186
• glycogenin 1
• glycogenin
• glycogenin-1
• GN1
• GN-1
• GSD15
• GYG

Background

Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substratefor glycogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glycogenin 1 Antibody (H00002992-M07)(12)

Publications using H00002992-M07

• Endoh M, Baba M, Endoh T et al. A FLCN-TFE3 Feedback Loop Prevents Excessive Glycogenesis and Phagocyte Activation by Regulating Lysosome Activity. Cell Rep. 2020-02-11 [PMID: 32049013]
• Carola H, Willem R, Ognian K et al. Functional characterization of GYG1 variants in two patients with myopathy and glycogenin-1 deficiency. Neuromuscul Disord. 2019-10-23 [PMID: 31791869]
• Visuttijai K, Carola H, Thomsen C et al. Glycogenin is dispensable for glycogen synthesis in human muscle and glycogenin deficiency causes polyglucosan storage. J Clin Endocrinol Metab. 2019-10-19 [PMID: 31628455]
• Ben Yaou R, Hubert A, Nelson I et al. Clinical heterogeneity and phenotype/genotype findings in 5 families with GYG1 deficiency. Neurol Genet 2017-12-18 [PMID: 29264399]
• Testoni G, Duran J, Garcia-Rocha M et al. Lack of Glycogenin Causes Glycogen Accumulation and Muscle Function Impairment Cell Metab. 2017-07-05 [PMID: 28683291] (Mouse)
• Hedberg-Oldfors C, Glamuzina E, Ruygrok P et al. Cardiomyopathy as presenting sign of glycogenin-1 deficiency-report of three cases and review of the literature. J Inherit Metab Dis 2016-10-07 [PMID: 27718144]
• Tasca G, Fattori F, Monforte M et al. Start codon mutation of GYG1 causing late-onset polyglucosan body myopathy with nemaline rods. J Neurol 2016-08-20 [PMID: 27544502]
• Malfatti E, Nilsson J, Hedberg-Oldfors C et al. A new muscle glycogen storage disease associated with Glycogenin-1 deficiency. Ann Neurol. 2014-10-31 [PMID: 25272951]
• Nilsson J, Halim A, Larsson E et al. LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences. Biochim Biophys Acta. 2013-11-14 [PMID: 24239874]
• Taylor KM, Meyers E, Phipps M et al. Dysregulation of multiple facets of glycogen metabolism in a murine model of Pompe disease. PLoS One. 2013-01-01 [PMID: 23457523]
• Nilsson J, Halim A, Moslemi AR et al. Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation. Biochim Biophys Acta. 2011-12-09 [PMID: 22198226]
• Shinozaki S, Choi CS, Shimizu N et al. Liver-specific iNOS expression is sufficient to cause hepatic insulin resistance and mild hyperglycemia in mice. J Biol Chem. 2011-08-16 [PMID: 21846719]

Bioinformatics

• Gene Symbol: GYG1
• Entrez:
  • 2992(Human)
• OMIM:
  • 603942(Human)
• Uniprot:
  • NP_004121(Human)