![Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/Fascin-2-Antibody-Western-Blot-NBP1-79776-img0004.jpg "Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FSCN2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
-Western-Blot-H00001406-M02-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-H00001406-M02-img0008.jpg)
-ELISA-H00001406-M02-img0007.jpg)
-Flow-Cytometry-NBP2-00714-img0001.jpg)
-Flow-Cytometry-NBP2-00714-img0002.jpg)
-Flow-Cytometry-NBP2-00714-img0003.jpg)
![Western Blot IMPDH1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IMP_Dehydrogenase_1_AF8554_Western_Blot_16658.jpg)
![Immunocytochemistry IMPDH1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IMP_Dehydrogenase_1_AF8554_Immunocytochemistry__Immunofluorescence_17605.jpg)
![Immunocytochemistry IMPDH1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af8554_human-mouse-rat-imp-dehydrogenase-1-impdh1-aff-pur-pab-immunocytochemistry-842022162057.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
XINHUI WANG |
IF | Rat | 06/05/2015 |
Summary
|
||||||||
Enlarge |
reviewed by:
XINHUI WANG |
WB | Rat | 05/22/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Fascin 2 Antibody (NBP1-79776)Discover more about diseases related to Fascin 2 Antibody (NBP1-79776).
| Pathways for Fascin 2 Antibody (NBP1-79776)View related products by pathway.
|
PTMs for Fascin 2 Antibody (NBP1-79776)Learn more about PTMs related to Fascin 2 Antibody (NBP1-79776).
| Research Areas for Fascin 2 Antibody (NBP1-79776)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| XINHUI WANG 06/05/2015 |
||
| Application: | IF | |
| Species: | Rat |
| XINHUI WANG 05/22/2015 |
||
| Application: | WB | |
| Species: | Rat |
| Gene Symbol | FSCN2 |
| Uniprot |
|
![Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/Fascin-2-Antibody-Western-Blot-NBP1-79776-img0003.jpg "Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.")
![Simple Western Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Simple_Western_16531.jpg)
![Knockout Validated Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Knockout_Validated_23042.jpg)
![Immunohistochemistry Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Immunohistochemistry_12950.jpg)
![Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_MAB2186_Western_Blot_11051.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
