Fascin 2 Antibody

Images

 
Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.
Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fascin 2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSCN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against FSCN2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-79776 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fascin 2 Antibody

  • fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotuspurpuratus)
  • fascin-2
  • Retinal fascin
  • retinal)
  • RFSNRP30fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
AF2945
Species: Hu
Applications: WB
MAB2186
Species: Hu
Applications: WB, IHC, IP
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8554
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-79776
Species: Hu, Rt
Applications: WB

Publications for Fascin 2 Antibody (NBP1-79776) (0)

There are no publications for Fascin 2 Antibody (NBP1-79776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fascin 2 Antibody (NBP1-79776) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Rat.

Reviews using NBP1-79776:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Rat
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Fascin 2 NBP1-79776
Enlarge
reviewed by:
Anonymous
IF Rat 06/05/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedNRK cells
SpeciesRat

Blocking

Blocking Details1% BSA for 1 h

Primary Anitbody

Dilution Ratio10 ug/mL overnight at 4 °C

Secondary Antibody

Secondary DescriptionGoat-anti-rabbit TRITC conjugate
Secondary Manufacturer Cat#Sigma Cat#T6778

Details

Detection Notesexposure time 3s.
Fixation Detailsfixed in 2% paraformaldehyde for 10 min, washed with PBS for 10min twice, permeabilized with 1% Triton X-100 for 10 min
Wash DescriptionPBS twice for 10min
Western Blot Fascin 2 NBP1-79776
Enlarge
reviewed by:
Anonymous
WB Rat 05/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysate
SpeciesRat
LotQC30731

Blocking

Blocking Details5% NFDM for 1 h

Primary Anitbody

Dilution Ratio1:0000, 4 degree, overnight

Secondary Antibody

Secondary DescriptionPeroxidase-conjugated AffiniPure Goat Anti-Rabbit IgG Secondary Antibody
Secondary Manufacturer Cat#Jackson ImmunoReasearch #95093
Secondary Concentration1:20000

Details

Detection NotesECL using the Femto ECL ( Pierce #34095) and image on the Chemdoc. Exposure time: 6s

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fascin 2 Antibody (NBP1-79776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-79776

Bioinformatics Tool for Fascin 2 Antibody (NBP1-79776)

Discover related pathways, diseases and genes to Fascin 2 Antibody (NBP1-79776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fascin 2 Antibody (NBP1-79776)

Discover more about diseases related to Fascin 2 Antibody (NBP1-79776).
 

Pathways for Fascin 2 Antibody (NBP1-79776)

View related products by pathway.

PTMs for Fascin 2 Antibody (NBP1-79776)

Learn more about PTMs related to Fascin 2 Antibody (NBP1-79776).

Blogs on Fascin 2

There are no specific blogs for Fascin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
06/05/2015
Application: IF
Species: Rat

Anonymous
05/22/2015
Application: WB
Species: Rat

Bioinformatics

Gene Symbol FSCN2
Uniprot