Fascin 2 Antibody


Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.
Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB

Order Details

Fascin 2 Antibody Summary

Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against FSCN2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
NBP1-79776 in the following application:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fascin 2 Antibody

  • fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotuspurpuratus)
  • fascin-2
  • Retinal fascin
  • retinal)
  • RFSNRP30fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB

Publications for Fascin 2 Antibody (NBP1-79776) (0)

There are no publications for Fascin 2 Antibody (NBP1-79776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fascin 2 Antibody (NBP1-79776) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Rat.

Reviews using NBP1-79776:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Fascin 2 NBP1-79776
reviewed by:
IF Rat 06/05/2015


Sample TestedNRK cells


Blocking Details1% BSA for 1 h

Primary Anitbody

Dilution Ratio10 ug/mL overnight at 4 °C

Secondary Antibody

Secondary DescriptionGoat-anti-rabbit TRITC conjugate
Secondary Manufacturer Cat#Sigma Cat#T6778


Detection Notesexposure time 3s.
Fixation Detailsfixed in 2% paraformaldehyde for 10 min, washed with PBS for 10min twice, permeabilized with 1% Triton X-100 for 10 min
Wash DescriptionPBS twice for 10min
Western Blot Fascin 2 NBP1-79776
reviewed by:
WB Rat 05/22/2015


ApplicationWestern Blot
Sample TestedWhole cell lysate


Blocking Details5% NFDM for 1 h

Primary Anitbody

Dilution Ratio1:0000, 4 degree, overnight

Secondary Antibody

Secondary DescriptionPeroxidase-conjugated AffiniPure Goat Anti-Rabbit IgG Secondary Antibody
Secondary Manufacturer Cat#Jackson ImmunoReasearch #95093
Secondary Concentration1:20000


Detection NotesECL using the Femto ECL ( Pierce #34095) and image on the Chemdoc. Exposure time: 6s

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fascin 2 Antibody (NBP1-79776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-79776

Bioinformatics Tool for Fascin 2 Antibody (NBP1-79776)

Discover related pathways, diseases and genes to Fascin 2 Antibody (NBP1-79776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fascin 2 Antibody (NBP1-79776)

Discover more about diseases related to Fascin 2 Antibody (NBP1-79776).

Pathways for Fascin 2 Antibody (NBP1-79776)

View related products by pathway.

PTMs for Fascin 2 Antibody (NBP1-79776)

Learn more about PTMs related to Fascin 2 Antibody (NBP1-79776).

Blogs on Fascin 2

There are no specific blogs for Fascin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IF
Species: Rat

Application: WB
Species: Rat


Gene Symbol FSCN2