GTPBP9 Antibody


Independent Antibodies: Western Blot: GTPBP9 Antibody [NBP2-58957] - Analysis using Anti-OLA1 antibody NBP2-58957 (A) shows similar pattern to independent antibody NBP1-89725 (B).
Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP2-58957] - Staining of human cell line U-2 OS shows localization to cytosol.
Genetic Strategies: Western Blot: GTPBP9 Antibody [NBP2-58957] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD

Order Details

GTPBP9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTK
Specificity of human GTPBP9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTPBP9 Recombinant Protein Antigen (NBP2-58957PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GTPBP9 Antibody

  • DKFZp313H1942
  • DNA damage-regulated overexpressed in cancer 45 protein
  • DOC45
  • EC 3.6.3
  • EC 3.6.3.-
  • GBP45
  • GTP-binding protein 9 (putative)
  • GTP-binding protein 9
  • GTP-binding protein PTD004
  • GTPBP9
  • homologous yeast-44.2 protein
  • Obg-like ATPase 1
  • PTD004


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
Species: Hu
Applications: WB, IHC, Block
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, KD

Publications for GTPBP9 Antibody (NBP2-58957) (0)

There are no publications for GTPBP9 Antibody (NBP2-58957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTPBP9 Antibody (NBP2-58957) (0)

There are no reviews for GTPBP9 Antibody (NBP2-58957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTPBP9 Antibody (NBP2-58957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GTPBP9 Products

Bioinformatics Tool for GTPBP9 Antibody (NBP2-58957)

Discover related pathways, diseases and genes to GTPBP9 Antibody (NBP2-58957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP9 Antibody (NBP2-58957)

Discover more about diseases related to GTPBP9 Antibody (NBP2-58957).

Pathways for GTPBP9 Antibody (NBP2-58957)

View related products by pathway.

Blogs on GTPBP9

There are no specific blogs for GTPBP9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GTPBP9 Antibody and receive a gift card or discount.


Gene Symbol OLA1