GTF2A1L Antibody (2E3)

Images

 
Immunocytochemistry/ Immunofluorescence: GTF2A1L Antibody (2E3) [H00011036-M02] - Analysis of monoclonal antibody to GTF2A1L on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: GTF2A1L Antibody (2E3) [H00011036-M02] - Analysis of GTF2A1L transfected lysate using anti-GTF2A1L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GTF2A1L MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GTF2A1L Antibody (2E3) Summary

Immunogen
ALF (NP_006863, 251 a.a. ~ 349 a.a) partial recombinant protein with GST tag.PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVT DIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDL SIRVTDDDIGEIIQ
Localization
Nuclear
Specificity
ALF - TFIIA-alpha/beta-like factor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GTF2A1L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF2A1L Antibody (2E3)

  • 1-like factor
  • general transcription factor IIA, 1-like
  • GTF2A1LF
  • MGC26254
  • TFIIA large subunit isoform ALF
  • TFIIA-alpha and beta-like factor
  • TFIIA-alpha/beta-like factor

Background

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
NBP2-16760
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00011037-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80795
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011036-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for GTF2A1L Antibody (H00011036-M02) (0)

There are no publications for GTF2A1L Antibody (H00011036-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2A1L Antibody (H00011036-M02) (0)

There are no reviews for GTF2A1L Antibody (H00011036-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTF2A1L Antibody (H00011036-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF2A1L Products

Bioinformatics Tool for GTF2A1L Antibody (H00011036-M02)

Discover related pathways, diseases and genes to GTF2A1L Antibody (H00011036-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2A1L Antibody (H00011036-M02)

Discover more about diseases related to GTF2A1L Antibody (H00011036-M02).
 

Pathways for GTF2A1L Antibody (H00011036-M02)

View related products by pathway.

PTMs for GTF2A1L Antibody (H00011036-M02)

Learn more about PTMs related to GTF2A1L Antibody (H00011036-M02).

Blogs on GTF2A1L

There are no specific blogs for GTF2A1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2A1L Antibody (2E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2A1L
Entrez
OMIM
Uniprot