GSTZ1 Antibody

Images

 
Western Blot: GSTZ1 Antibody [H00002954-B01P] - Analysis of GSTZ1 expression in human liver.
Western Blot: GSTZ1 Antibody [H00002954-B01P] - Analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 polyclonal antibody. Lane1:GSTZ1 transfected lysate(23.76 KDa). Lane2:Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSTZ1 Antibody Summary

Immunogen
GSTZ1 (NP_665877.1, 1 a.a. - 216 a.a.) full-length human protein. MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Specificity
GSTZ1 - glutathione transferase zeta 1 (maleylacetoacetate isomerase),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GSTZ1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTZ1 Antibody

  • EC 2.5.1.18
  • EC 5.2.1.2
  • glutathione S-alkyltransferase
  • glutathione S-aralkyltransferase
  • Glutathione S-transferase zeta 1
  • glutathione transferase zeta 1
  • GSTZ1-1maleylacetoacetate isomerase
  • MAAIglutathione S-aryltransferase
  • MAI
  • maleylacetone isomerase
  • MGC2029
  • S-(hydroxyalkyl)glutathione lyase

Background

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for GSTZ1 Antibody (H00002954-B01P) (0)

There are no publications for GSTZ1 Antibody (H00002954-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTZ1 Antibody (H00002954-B01P) (0)

There are no reviews for GSTZ1 Antibody (H00002954-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTZ1 Antibody (H00002954-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTZ1 Products

Bioinformatics Tool for GSTZ1 Antibody (H00002954-B01P)

Discover related pathways, diseases and genes to GSTZ1 Antibody (H00002954-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTZ1 Antibody (H00002954-B01P)

Discover more about diseases related to GSTZ1 Antibody (H00002954-B01P).
 

Pathways for GSTZ1 Antibody (H00002954-B01P)

View related products by pathway.

PTMs for GSTZ1 Antibody (H00002954-B01P)

Learn more about PTMs related to GSTZ1 Antibody (H00002954-B01P).

Blogs on GSTZ1

There are no specific blogs for GSTZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTZ1
Entrez
Uniprot