GSTO1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP1-83321] - Analysis in human liver and pancreas tissues using NBP1-83321 antibody. Corresponding GSTO1 RNA-seq data are presented for the same tissues.

Staining of human kidney, liver, pancreas and testis using NBP1-83321 (A) shows similar protein distribution across tissues to independent antibody NBP2-32691 (B).

Staining of human testis shows weak cytoplasmic positivity in Leydig cells as expected.

Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human kidney shows moderate cytoplasmic positivity in cells) in tubules.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GSTO1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GSTO1 Antibody - BSA Free (NBP1-83321) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GSTO1 Protein (NBP1-83321PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GSTO1 Antibody - BSA Free

• DKFZp686H13163
• EC 2.5.1.18
• glutathione S-transferase omega 1
• glutathione S-transferase omega 1-1
• glutathione S-transferase omega-1
• glutathione-S-transferase like
• GSTO-1
• GSTTLp28
• P28

Background

GSTO1 encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTO1