GSTM4 Antibody

Images

 
Western Blot: GSTM4 Antibody [H00002948-D01P] - Analysis of GSTM4 expression in human liver.
Western Blot: GSTM4 Antibody [H00002948-D01P] - Analysis of GSTM4 expression in transfected 293T cell line by GSTM4 polyclonal antibody.Lane 1: GSTM4 transfected lysate(25.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTM4 Antibody Summary

Immunogen
GSTM4 (NP_000841.1, 1 a.a. - 218 a.a.) full-length human protein. MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Specificity
GSTM4,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTM4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTM4 Antibody

  • EC 2.5.1.18
  • glutathione S-alkyltransferase M4
  • glutathione S-aralkyltransferase M4
  • glutathione S-aryltransferase M4
  • glutathione S-transferase M4
  • glutathione S-transferase mu 4
  • GST class-mu 4
  • GSTM4-4
  • GST-Mu2
  • GTM4
  • GTS-Mu2
  • MGC131945
  • MGC9247
  • S-(hydroxyalkyl)glutathione lyase M4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-32682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-32157
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GSTM4 Antibody (H00002948-D01P) (0)

There are no publications for GSTM4 Antibody (H00002948-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTM4 Antibody (H00002948-D01P) (0)

There are no reviews for GSTM4 Antibody (H00002948-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTM4 Antibody (H00002948-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTM4 Products

Bioinformatics Tool for GSTM4 Antibody (H00002948-D01P)

Discover related pathways, diseases and genes to GSTM4 Antibody (H00002948-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTM4 Antibody (H00002948-D01P)

Discover more about diseases related to GSTM4 Antibody (H00002948-D01P).
 

Pathways for GSTM4 Antibody (H00002948-D01P)

View related products by pathway.

PTMs for GSTM4 Antibody (H00002948-D01P)

Learn more about PTMs related to GSTM4 Antibody (H00002948-D01P).

Blogs on GSTM4

There are no specific blogs for GSTM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTM4
Entrez
Uniprot