GSTA4 Antibody

Images

 
Western Blot: GSTA4 Antibody [H00002941-B02P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody. Lane 1: GSTA4 transfected lysate(24.42 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSTA4 Antibody Summary

Immunogen
GSTA4 (NP_001503.1, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GSTA4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody

  • DKFZp686D21185
  • EC 2.5.1.18
  • glutathione S-alkyltransferase A4
  • glutathione S-aralkyltransferase A4
  • glutathione S-aryltransferase A4
  • glutathione S-transferase A4
  • Glutathione S-transferase A4-4
  • glutathione S-transferase alpha 4
  • glutathione transferase A4-4
  • GST class-alpha member 4
  • GSTA4-4
  • GTA4
  • S-(hydroxyalkyl)glutathione lyase A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-86140
Species: Hu
Applications: WB, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-03126
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002941-B02P
Species: Hu
Applications: WB

Publications for GSTA4 Antibody (H00002941-B02P) (0)

There are no publications for GSTA4 Antibody (H00002941-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA4 Antibody (H00002941-B02P) (0)

There are no reviews for GSTA4 Antibody (H00002941-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTA4 Antibody (H00002941-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTA4 Products

Bioinformatics Tool for GSTA4 Antibody (H00002941-B02P)

Discover related pathways, diseases and genes to GSTA4 Antibody (H00002941-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA4 Antibody (H00002941-B02P)

Discover more about diseases related to GSTA4 Antibody (H00002941-B02P).
 

Pathways for GSTA4 Antibody (H00002941-B02P)

View related products by pathway.

PTMs for GSTA4 Antibody (H00002941-B02P)

Learn more about PTMs related to GSTA4 Antibody (H00002941-B02P).

Blogs on GSTA4

There are no specific blogs for GSTA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA4
Uniprot