GSTA3 Antibody

Images

 
Western Blot: GSTA3 Antibody [NBP2-82246] - Host: Rabbit. Target Name: GSTA3. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTA3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSTA3. Peptide sequence: FEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GSTA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTA3 Antibody

  • EC 2.5.1.18
  • glutathione S-alkyltransferase A3
  • glutathione S-aralkyltransferase A3
  • glutathione S-aryltransferase A3
  • glutathione S-transferase A3
  • Glutathione S-transferase A3-3
  • glutathione S-transferase alpha 3
  • GST class-alpha member 3
  • GSTA3-3
  • GTA3
  • MGC22232
  • S-(hydroxyalkyl)glutathione lyase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00002938-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002941-D01P
Species: Hu, Mu
Applications: IHC, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002551-M03
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP1-32157
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
H00002946-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-97493
Species: Eq, Fi, Hu, Mu, Rb, Rt
Applications: EIA, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00221357-D01P
Species: Hu
Applications: WB
314-BP/CF
Species: Hu
Applications: BA, BA

Publications for GSTA3 Antibody (NBP2-82246) (0)

There are no publications for GSTA3 Antibody (NBP2-82246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA3 Antibody (NBP2-82246) (0)

There are no reviews for GSTA3 Antibody (NBP2-82246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTA3 Antibody (NBP2-82246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTA3 Products

Bioinformatics Tool for GSTA3 Antibody (NBP2-82246)

Discover related pathways, diseases and genes to GSTA3 Antibody (NBP2-82246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA3 Antibody (NBP2-82246)

Discover more about diseases related to GSTA3 Antibody (NBP2-82246).
 

Pathways for GSTA3 Antibody (NBP2-82246)

View related products by pathway.

PTMs for GSTA3 Antibody (NBP2-82246)

Learn more about PTMs related to GSTA3 Antibody (NBP2-82246).
 

Research Areas for GSTA3 Antibody (NBP2-82246)

Find related products by research area.

Blogs on GSTA3

There are no specific blogs for GSTA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA3