GST Epitope Tag Antibody

Images

 
Western Blot: Glutathione S-transferase Mu 5 Antibody [NBP2-14074] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunohistochemistry-Paraffin: Glutathione S-transferase Mu 5 Antibody [NBP2-14074] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GST Epitope Tag Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Appendix Lysate (NB820-59172)
Control Peptide
GST Epitope Tag Recombinant Protein Antigen (NBP2-14074PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GST Epitope Tag Antibody

  • EC 2.5.1.18
  • glutathione S-alkyltransferase
  • glutathione S-aralkyltransferase
  • glutathione S-aryltransferase
  • glutathione S-transferase M1
  • glutathione S-transferase mu 1
  • GST class-mu 1
  • GST HB subunit 4
  • GST1
  • GSTM1-1
  • GSTM1a-1a
  • GSTM1b-1b
  • GTH4
  • GTM1
  • HB subunit 4
  • H-B
  • MGC26563
  • MU
  • MU-1
  • S-(hydroxyalkyl)glutathione lyase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC

Publications for GST Epitope Tag Antibody (NBP2-14074) (0)

There are no publications for GST Epitope Tag Antibody (NBP2-14074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GST Epitope Tag Antibody (NBP2-14074) (0)

There are no reviews for GST Epitope Tag Antibody (NBP2-14074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GST Epitope Tag Antibody (NBP2-14074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional GST Epitope Tag Products

Bioinformatics Tool for GST Epitope Tag Antibody (NBP2-14074)

Discover related pathways, diseases and genes to GST Epitope Tag Antibody (NBP2-14074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GST Epitope Tag Antibody (NBP2-14074)

Discover more about diseases related to GST Epitope Tag Antibody (NBP2-14074).
 

Pathways for GST Epitope Tag Antibody (NBP2-14074)

View related products by pathway.

PTMs for GST Epitope Tag Antibody (NBP2-14074)

Learn more about PTMs related to GST Epitope Tag Antibody (NBP2-14074).
 

Research Areas for GST Epitope Tag Antibody (NBP2-14074)

Find related products by research area.

Blogs on GST Epitope Tag

There are no specific blogs for GST Epitope Tag, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GST Epitope Tag Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTM1