GSKIP Antibody

Western Blot: GSKIP Antibody [NBP2-30378] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: GSKIP Antibody [NBP2-30378] - Staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GSKIP Antibody [NBP2-30378] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: GSKIP Antibody [NBP2-30378] - Staining of human small intestine shows strong cytoplasmic positivity in goblet cells.

Immunohistochemistry-Paraffin: GSKIP Antibody [NBP2-30378] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and leydig cells.

Immunohistochemistry-Paraffin: GSKIP Antibody [NBP2-30378] - Staining of human kidney shows moderate nuclear positivity in glomeruli and cells in tubules.

Product Discontinued

GSKIP Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET
• Predicted Species: Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSKIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GSKIP Antibody

• chromosome 14 open reading frame 129
• GSK3beta interaction protein
• GSK3-beta interaction protein
• GSKIP
• MGC4945

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSKIP
• Uniprot:
  • Q9P0R6(Human)