Recombinant Human GRO2 Protein Summary
Description |
CXCL2 (Human) Recombinant Protein
Source: E. coli
Amino Acid Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Preparation Method |
Escherichia coli expression system |
Details of Functionality |
The activity is determined by the ability to chemoattract purified human neutrophils and is detectable starting at 10 ng/mL. |
Protein/Peptide Type |
Recombinant Protein |
Gene |
CXCL2 |
Applications/Dilutions
Dilutions |
|
Application Notes |
This product is useful for Func,SDS-PAGE. |
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
No additive Reconstitute with sterilized water. |
Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human GRO2 Protein
Background
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatorychemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highlyenhanced hematopoietic activity
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for GRO2 Recombinant Protein (P4396) (0)
There are no publications for GRO2 Recombinant Protein (P4396).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRO2 Recombinant Protein (P4396) (0)
There are no reviews for GRO2 Recombinant Protein (P4396).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GRO2 Recombinant Protein (P4396) (0)
Additional GRO2 Products
Research Areas for GRO2 Recombinant Protein (P4396)
Find related products by research area.
|
Blogs on GRO2