GRHL1 Antibody - BSA Free

Western Blot: GRHL1 Antibody [NBP1-81322] - Analysis in control (vector only transfected HEK293T lysate) and GRHL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: GRHL1 Antibody [NBP1-81322] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining in human skin and skeletal muscle tissues using NBP1-81322 antibody. Corresponding GRHL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human skin shows moderate to strong nuclear positivity in a subset of squamous epithelial cells.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-GRHL1 antibody NBP1-81322 (A) shows similar protein distribution across tissues to independent antibody NBP1-81321 (B).

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81322] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRHL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNK
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRHL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRHL1 Protein (NBP1-81322PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23690579)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRHL1 Antibody - BSA Free

• grainyhead-like 1 (Drosophila)
• grainyhead-like protein 1 homolog
• LBP protein 32
• MGRLBP-32
• NH32
• TFCP2L2
• Transcription factor CP2-like 2LBP32Mammalian grainyhead
• Transcription factor LBP-32

Background

GRHL1 encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRHL1 Antibody (NBP1-81322)(1)

Publication using NBP1-81322

• Gao X, Vockley CM, Pauli F et al. Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium. Proc Natl Acad Sci U S A 2013-06-04 [PMID: 23690579]

Bioinformatics

• Gene Symbol: GRHL1