Recombinant Human GRASP65 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GRASP65 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 341-440 of Human GORASP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GORASP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRASP65 Protein

  • Golgi peripheral membrane protein p65
  • Golgi phosphoprotein 5MGC118897
  • golgi reassembly stacking protein 1, 65kDa
  • Golgi reassembly-stacking protein 1
  • Golgi reassembly-stacking protein of 65 kDa
  • GRASP65MGC118894
  • P6565 kDa

Background

GORASP1 - golgi reassembly stacking protein 1, 65kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for GRASP65 Partial Recombinant Protein (H00064689-Q01) (0)

There are no publications for GRASP65 Partial Recombinant Protein (H00064689-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRASP65 Partial Recombinant Protein (H00064689-Q01) (0)

There are no reviews for GRASP65 Partial Recombinant Protein (H00064689-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRASP65 Partial Recombinant Protein (H00064689-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRASP65 Products

Bioinformatics Tool for GRASP65 Partial Recombinant Protein (H00064689-Q01)

Discover related pathways, diseases and genes to GRASP65 Partial Recombinant Protein (H00064689-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRASP65 Partial Recombinant Protein (H00064689-Q01)

Discover more about diseases related to GRASP65 Partial Recombinant Protein (H00064689-Q01).
 

Pathways for GRASP65 Partial Recombinant Protein (H00064689-Q01)

View related products by pathway.

PTMs for GRASP65 Partial Recombinant Protein (H00064689-Q01)

Learn more about PTMs related to GRASP65 Partial Recombinant Protein (H00064689-Q01).
 

Research Areas for GRASP65 Partial Recombinant Protein (H00064689-Q01)

Find related products by research area.

Blogs on GRASP65

There are no specific blogs for GRASP65, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRASP65 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GORASP1