Granzyme K Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Staining of human duodenum shows low expression as expected.

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Analysis in human lymph node and duodenum tissues using Anti-GZMK antibody. Corresponding GZMK RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Staining of human lymph node shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Granzyme K Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GZMK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Granzyme K Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.4
• Fragmentin-3
• Granzyme 3
• granzyme K (granzyme 3; tryptase II)
• granzyme K (serine protease, granzyme 3; tryptase II)
• Granzyme K
• Granzyme-3
• Granzyme-K
• GZMK
• NK-Tryp-2
• NK-Tryptase-2
• PRSS
• TRYP2
• TRYP2granzyme-3
• Tryptase II

Background

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GZMK