GPR161 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR161 Antibody [NBP1-87146] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR161 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR161
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR161 Protein (NBP1-87146PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR161 Antibody

  • FLJ33952
  • G protein-coupled receptor 161
  • Gm208
  • GPR161
  • G-protein coupled receptor 161
  • G-protein coupled receptor RE2
  • RE2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR161 Antibody (NBP1-87146) (0)

There are no publications for GPR161 Antibody (NBP1-87146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR161 Antibody (NBP1-87146) (0)

There are no reviews for GPR161 Antibody (NBP1-87146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR161 Antibody (NBP1-87146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR161 Products

Bioinformatics Tool for GPR161 Antibody (NBP1-87146)

Discover related pathways, diseases and genes to GPR161 Antibody (NBP1-87146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR161 Antibody (NBP1-87146)

Discover more about diseases related to GPR161 Antibody (NBP1-87146).
 

Pathways for GPR161 Antibody (NBP1-87146)

View related products by pathway.

Research Areas for GPR161 Antibody (NBP1-87146)

Find related products by research area.

Blogs on GPR161

There are no specific blogs for GPR161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR161 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR161
Entrez