GPR161 Antibody


Western Blot: GPR161 Antibody [NBP1-69244] - This Anti-GPR161 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry-Paraffin: GPR161 Antibody [NBP1-69244] - Human kidney, epithelial cells of renal tubule (indicated with arrows), stained with GPR161 Antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GPR161 Antibody Summary

Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the N terminal of GPR161. Peptide sequence MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 2.5 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPR161 Antibody

  • FLJ33952
  • G protein-coupled receptor 161
  • Gm208
  • GPR161
  • G-protein coupled receptor 161
  • G-protein coupled receptor RE2
  • RE2


GPR161 is orphan receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR161 Antibody (NBP1-69244) (0)

There are no publications for GPR161 Antibody (NBP1-69244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR161 Antibody (NBP1-69244) (0)

There are no reviews for GPR161 Antibody (NBP1-69244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR161 Antibody (NBP1-69244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR161 Products

Bioinformatics Tool for GPR161 Antibody (NBP1-69244)

Discover related pathways, diseases and genes to GPR161 Antibody (NBP1-69244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR161 Antibody (NBP1-69244)

Discover more about diseases related to GPR161 Antibody (NBP1-69244).

Pathways for GPR161 Antibody (NBP1-69244)

View related products by pathway.

Research Areas for GPR161 Antibody (NBP1-69244)

Find related products by research area.

Blogs on GPR161

There are no specific blogs for GPR161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR161 Antibody and receive a gift card or discount.


Gene Symbol GPR161