GPR152 Antibody - BSA Free

Western Blot: GPR152 Antibody [NBP2-85006] - Host: Rabbit. Target Name: GPR152. Sample Tissue: Mouse Kidney lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR152 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse GPR152. Peptide sequence: GLPANGLMAWLAGSQARHGAGTRLALLLLSLALSDFLFLAAATFQILEIQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR152
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR152 Antibody - BSA Free

• G protein-coupled receptor 152
• G protein-coupled receptor PGR5
• GPR152
• G-protein coupled receptor PGR5
• PGR5
• PGR5MGC148162
• probable G-protein coupled receptor 152

Background

G protein-coupled receptor LS190484 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from a human lung cancer library and from a human normal pooled lung and spleen library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR152