GPR123 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR123 Antibody [NBP1-82890] - Staining of human testis shows distinct positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR123 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGRTKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR123
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR123 Protein (NBP1-82890PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR123 Antibody

  • FLJ37356
  • G protein-coupled receptor 123
  • GPR123
  • KIAA1828
  • KIAA1828FLJ25875
  • probable G-protein coupled receptor 123

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4634
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-03561
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NLS2167
Species: Hu, Po, Bt, Ca, Eq, Mk, Rb
Applications: IHC-P
NBP2-16717
Species: Hu
Applications: WB
NLS1720
Species: Hu
Applications: IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3688
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-32686
Species: Hu
Applications: WB, IHC, IHC-P
AF4894
Species: Hu
Applications: WB, Neut
AF7977
Species: Hu, Mu, Rt
Applications: WB, IHC
H00326342-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
MAB8496
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-02374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41292
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IF
AF1031
Species: Hu
Applications: WB, IP, ICC

Publications for GPR123 Antibody (NBP1-82890) (0)

There are no publications for GPR123 Antibody (NBP1-82890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR123 Antibody (NBP1-82890) (0)

There are no reviews for GPR123 Antibody (NBP1-82890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR123 Antibody (NBP1-82890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR123 Products

Bioinformatics Tool for GPR123 Antibody (NBP1-82890)

Discover related pathways, diseases and genes to GPR123 Antibody (NBP1-82890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR123 Antibody (NBP1-82890)

Discover more about diseases related to GPR123 Antibody (NBP1-82890).
 

Pathways for GPR123 Antibody (NBP1-82890)

View related products by pathway.

Blogs on GPR123

There are no specific blogs for GPR123, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR123 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR123
Entrez