FANK1 Antibody

Western Blot: FANK1 Antibody [NBP1-86258] - Analysis in control (vector only transfected HEK293T lysate) and FANK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Immunofluorescence: FANK1 Antibody [NBP1-86258] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FANK1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FANK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FANK1 Protein (NBP1-86258PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FANK1 Antibody

• 1700007B22Rik
• fibronectin type 3 and ankyrin repeat domains 1
• fibronectin type 3 and ankyrin repeat domains protein 1
• fibronectin type III and ankyrin repeat domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FANK1