We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GPIP137 Recombinant Protein Antigen

Images

 
There are currently no images for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPIP137 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPIP137.

Source: E. coli

Amino Acid Sequence: TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPRIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57388.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPIP137 Recombinant Protein Antigen

  • activation/proliferation-associated protein 1
  • caprin 1
  • caprin-1
  • cell cycle associated protein 1
  • Cell cycle-associated protein 1
  • Cytoplasmic activation- and proliferation-associated protein 1
  • cytoplasmic activation/proliferation-associated protein-1
  • GPI-anchored membrane protein 1GPIP137
  • GPI-p137
  • M11S1GPI-anchored protein p137
  • Membrane component chromosome 11 surface marker 1
  • membrane component, chromosome 11, surface marker 1
  • p137GPI
  • RNA granule protein 105
  • RNG105GPIAP1

Background

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010146-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88318
Species: Hu
Applications: ICC/IF,  IHC-P
NBP3-16379
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-89166
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-79842
Species: Hu, Mu
Applications: IP, WB
AF5956
Species: Hu, Mu
Applications: WB
NBP2-13760
Species: Hu
Applications: IHC,  IHC-P
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-57388PEP
Species: Hu
Applications: AC

Publications for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP) (0)

There are no publications for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP) (0)

There are no reviews for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPIP137 Recombinant Protein Antigen (NBP2-57388PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPIP137 Products

Blogs on GPIP137

There are no specific blogs for GPIP137, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPIP137 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPRIN1