GPI-PLD/GPLD1 Antibody - BSA Free

Western Blot: GPI-PLD/GPLD1 Antibody [NBP2-84999] - WB Suggested Anti-GPLD1 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellGPLD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPI-PLD/GPLD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPI-PLD/GPLD1 Antibody - BSA Free (NBP2-84999) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPI-PLD/GPLD1. Peptide sequence: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPLD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPI-PLD/GPLD1 Antibody - BSA Free

• EC 3.1.4.50
• Glycoprotein Phospholipase D
• glycosylphosphatidylinositol specific phospholipase D1
• Glycosyl-phosphatidylinositol-specific phospholipase D
• glycosylphosphatIdylinositol-specific phospholipase D
• GPIPLD
• GPI-PLD
• GPIPLDM
• GPI-specific phospholipase D
• GPLD1
• MGC22590
• phosphatidylinositol-glycan-specific phospholipase D
• phospholipase D, phosphatidylinositol-glycan-specific
• PI-G PLD
• PIGPLD
• PIGPLD1
• PLD

Background

Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol(GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPIdegrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage inproteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPLD1