Recombinant Human GPER/GPR30 Protein

• Reactivity: Hu
• Applications: AP

Recombinant Human GPER/GPR30 Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (NP_001496.1) for Human GPER/GPR30
  
  

  Source: Wheat Germ (in vitro) with proprietary liposome technology

  Amino Acid Sequence: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV

• Preparation Method: in vitro wheat germ expression system with proprietary liposome technology
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: GPER1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Immunoaffinity Purification
• Theoretical MW: 42.2 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 25 mM Tris-HCl pH8.0 in 2% glycerol.
• Preservative: Glycerol
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPER/GPR30 Protein

• CEPR
• CEPRG-protein coupled receptor 30
• Chemoattractant receptor-like 2
• chemokine receptor-like 2
• CMKRL2
• CMKRL2MGC99678
• constitutively expressed peptide-like receptor
• DRY12
• DRY12IL8-related receptor DRY12
• FEG-1
• FEG-1mER
• Flow-induced endothelial G-protein coupled receptor 1
• G protein-coupled estrogen receptor 1
• G protein-coupled receptor 30
• GPCR-BR
• GPER
• GPR30
• GPR30GPCR-Br
• G-protein coupled estrogen receptor 1
• heptahelix receptor
• LERGU
• LERGU2
• leucine rich protein in GPR30 3'UTR
• LyGPR
• Lymphocyte-derived G-protein coupled receptor
• Membrane estrogen receptor

Background

GPR30 a former orphan receptor has been linked to estrogen-mediated activation of adenylyl cyclase, release of epidermal growth factor (EGF)-related ligands, and specific estrogen binding.1 GPR30 acts independently of estrogen receptors, ERalpha and ERbeta, to release of heparin-binding EGF and may play a role in breast cancer tumorogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GPER1