Recombinant Human GPANK1/BAT4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPANK1/BAT4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 257-356 of Human BAT4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPANK1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPANK1/BAT4 Protein

  • 6S54E
  • ANKRD59Protein G5
  • Ankyrin repeat domain-containing protein 59
  • BAT4G patch domain containing 10
  • D6S54EG patch domain and ankyrin repeats-containing protein 1
  • G patch domain and ankyrin repeats 1
  • G patch domain-containing protein 10
  • G5HLA-B-associated transcript 4
  • GPATCH10HLA-B associated transcript 4
  • protein BAT4

Background

BAT4 - HLA-B associated transcript 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-71706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
H00007918-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01) (0)

There are no publications for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01) (0)

There are no reviews for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPANK1/BAT4 Products

Bioinformatics Tool for GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01)

Discover related pathways, diseases and genes to GPANK1/BAT4 Partial Recombinant Protein (H00007918-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GPANK1/BAT4

There are no specific blogs for GPANK1/BAT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPANK1/BAT4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPANK1