gp130/CD130 Antibody (B-R3) [FITC] Summary
| Description |
TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4 Da.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 Da. |
| Immunogen |
Natural soluble gp130 receptor (Human). |
| Localization |
Type I membrane (isoform 1). Secreted (isoform 2). |
| Specificity |
CD130 (B-R3) |
| Isotype |
IgG2a |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
IL6ST |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Flow Cytometry 1:10-1:1000
|
| Control |
|
Reactivity Notes
Cross-reacts with Human. Not yet tested in other species.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS (pH 7.4) and 1.0% BSA |
| Preservative |
0.05% Sodium Azide |
| Purity |
IgG purified |
Alternate Names for gp130/CD130 Antibody (B-R3) [FITC]
Background
CD130 is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Flow
Publications for gp130/CD130 Antibody (NB120-11461) (0)
There are no publications for gp130/CD130 Antibody (NB120-11461).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for gp130/CD130 Antibody (NB120-11461) (0)
There are no reviews for gp130/CD130 Antibody (NB120-11461).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for gp130/CD130 Antibody (NB120-11461) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional gp130/CD130 Products
Research Areas for gp130/CD130 Antibody (NB120-11461)
Find related products by research area.
|
Blogs on gp130/CD130