Golgin 97 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the N terminal of human GOLGA1. Peptide sequence RPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQI. The peptide sequence for this immunogen was taken from within the described region. |
| Marker |
TGN Marker |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GOLGA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
88 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Golgin 97 Antibody - BSA Free
Background
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein is associated with Sjogren's syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for Golgin 97 Antibody (NBP1-79554) (0)
There are no publications for Golgin 97 Antibody (NBP1-79554).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Golgin 97 Antibody (NBP1-79554) (0)
There are no reviews for Golgin 97 Antibody (NBP1-79554).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Golgin 97 Antibody (NBP1-79554) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Golgin 97 Products
Research Areas for Golgin 97 Antibody (NBP1-79554)
Find related products by research area.
|
Blogs on Golgin 97