ARFIP2 Antibody

Western Blot: ARFIP2 Antibody [NBP1-87255] - Analysis in control (vector only transfected HEK293T lysate) and ARFIP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ARFIP2 Antibody [NBP1-87255] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Analysis in human prostate and skeletal muscle tissues. Corresponding ARFIP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARFIP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYG
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARFIP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARFIP2 Protein (NBP1-87255PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARFIP2 Antibody

• ADP-ribosylation factor interacting protein 2
• ADP-ribosylation factor-interacting protein 2
• arfaptin 2
• arfaptin-2
• Partner of RAC1
• POR1partner of RAC1 (arfaptin 2)
• Protein POR1

Background

Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARFIP2
• Entrez:
  • 23647(Human)
• Uniprot:
  • P53365(Human)