ARFIP2 Antibody

Images

 
Western Blot: ARFIP2 Antibody [NBP1-87255] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ARFIP2 Antibody [NBP1-87255] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and golgi apparatus.
Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARFIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYG
Specificity
Specificity of human ARFIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:20
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
ARFIP2 Lysate (NBP2-65356)
Control Peptide
ARFIP2 Protein (NBP1-87255PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFIP2 Antibody

  • ADP-ribosylation factor interacting protein 2
  • ADP-ribosylation factor-interacting protein 2
  • arfaptin 2
  • arfaptin-2
  • Partner of RAC1
  • POR1partner of RAC1 (arfaptin 2)
  • Protein POR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-39002
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NLS2656
Species: Hu
Applications: WB, ICC/IF, IHC-P, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87255
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARFIP2 Antibody (NBP1-87255) (0)

There are no publications for ARFIP2 Antibody (NBP1-87255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFIP2 Antibody (NBP1-87255) (0)

There are no reviews for ARFIP2 Antibody (NBP1-87255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARFIP2 Antibody (NBP1-87255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ARFIP2 Products

Bioinformatics Tool for ARFIP2 Antibody (NBP1-87255)

Discover related pathways, diseases and genes to ARFIP2 Antibody (NBP1-87255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFIP2 Antibody (NBP1-87255)

Discover more about diseases related to ARFIP2 Antibody (NBP1-87255).
 

Pathways for ARFIP2 Antibody (NBP1-87255)

View related products by pathway.

PTMs for ARFIP2 Antibody (NBP1-87255)

Learn more about PTMs related to ARFIP2 Antibody (NBP1-87255).
 

Research Areas for ARFIP2 Antibody (NBP1-87255)

Find related products by research area.

Blogs on ARFIP2

There are no specific blogs for ARFIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFIP2
Entrez
Uniprot