Recombinant Human GOLGA5 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GOLGA5 Protein [H00009950-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GOLGA5 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-99 of Human GOLGA5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GOLGA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GOLGA5 GST (N-Term) Protein

  • Cell proliferation-inducing gene 31 protein
  • golgi autoantigen, golgin subfamily a, 5
  • golgin A5
  • Golgin subfamily A member 5
  • Golgin-84
  • GOLIM5
  • Protein Ret-II
  • PTC5
  • RET-fused gene 5 protein
  • RETII
  • ret-II
  • rfg5
  • RFG5golgi integral membrane protein 5

Background

GOLGA5 - golgi autoantigen, golgin subfamily a, 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP2-22321
Species: Hu
Applications: WB, ICC/IF, IP
AF482
Species: Mu
Applications: WB, IHC
NBP2-53420
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010491-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-1002
Species: Hu
Applications: WB, PEP-ELISA, IF
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-80973
Species: Hu
Applications: WB, IHC, IHC-P, KD
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-55113
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for GOLGA5 Partial Recombinant Protein (H00009950-Q01) (0)

There are no publications for GOLGA5 Partial Recombinant Protein (H00009950-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLGA5 Partial Recombinant Protein (H00009950-Q01) (0)

There are no reviews for GOLGA5 Partial Recombinant Protein (H00009950-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GOLGA5 Partial Recombinant Protein (H00009950-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GOLGA5 Products

Bioinformatics Tool for GOLGA5 Partial Recombinant Protein (H00009950-Q01)

Discover related pathways, diseases and genes to GOLGA5 Partial Recombinant Protein (H00009950-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA5 Partial Recombinant Protein (H00009950-Q01)

Discover more about diseases related to GOLGA5 Partial Recombinant Protein (H00009950-Q01).
 

Pathways for GOLGA5 Partial Recombinant Protein (H00009950-Q01)

View related products by pathway.

PTMs for GOLGA5 Partial Recombinant Protein (H00009950-Q01)

Learn more about PTMs related to GOLGA5 Partial Recombinant Protein (H00009950-Q01).
 

Research Areas for GOLGA5 Partial Recombinant Protein (H00009950-Q01)

Find related products by research area.

Blogs on GOLGA5

There are no specific blogs for GOLGA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GOLGA5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA5