GNPDA1 Antibody

Images

 
Western Blot: GNPDA1 Antibody [NBP1-83355] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17, Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: GNPDA1 Antibody [NBP1-83355] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP1-83355] - Staining of human testis shows moderate cytoplasmic positivity in germ cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNPDA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNPDA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNPDA1 Protein (NBP1-83355PEP)
Publications
Read Publication using NBP1-83355.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNPDA1 Antibody

  • EC 3.5.99.6
  • GlcN6P deaminase 1
  • glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA
  • glucosamine-6-phosphate isomerase 1
  • glucosamine-6-phosphate isomerase
  • GNP1
  • GNPDA 1
  • GPI
  • oscillin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
AF4466
Species: Hu, Mu
Applications: WB
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00079092-T01
Species: Hu
NBP1-83355
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GNPDA1 Antibody (NBP1-83355)(1)

Reviews for GNPDA1 Antibody (NBP1-83355) (0)

There are no reviews for GNPDA1 Antibody (NBP1-83355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNPDA1 Antibody (NBP1-83355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNPDA1 Products

Bioinformatics Tool for GNPDA1 Antibody (NBP1-83355)

Discover related pathways, diseases and genes to GNPDA1 Antibody (NBP1-83355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GNPDA1

There are no specific blogs for GNPDA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNPDA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPDA1