GNG11 Antibody

Product Discontinued

GNG11 Antibody Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNG11 (AAH09709, 1 a.a. - 73 a.a.) full-length recombinant protein with GST tag. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
• Specificity: GNG11 - guanine nucleotide binding protein (G protein), gamma 11
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GNG11
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: Whole antisera with 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNG11 Antibody

• GNGT11G protein gamma-11 subunit
• guanine nucleotide binding protein (G protein), gamma 11
• guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

Background

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG11
• Entrez:
  • 2791(Human)
• OMIM:
  • 604390(Human)
• Uniprot:
  • AAH09709(Human)