GNG10 Antibody - BSA Free

Images

 
Western Blot: GNG10 Antibody [NBP3-04765] - Analysis of extracts of various cell lines, using GNG10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

GNG10 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG10 (NP_001017998.1). MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNG10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000
Theoretical MW
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GNG10 Antibody - BSA Free

  • GNGT10
  • guanine nucleotide binding protein (G protein), gamma 10
  • guanine nucleotide binding protein 10
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10

Background

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in varioustransmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement ofGDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GNG10 Antibody (NBP3-04765) (0)

There are no publications for GNG10 Antibody (NBP3-04765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNG10 Antibody (NBP3-04765) (0)

There are no reviews for GNG10 Antibody (NBP3-04765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG10 Antibody (NBP3-04765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNG10 Products

Research Areas for GNG10 Antibody (NBP3-04765)

Find related products by research area.

Blogs on GNG10

There are no specific blogs for GNG10, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNG10 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG10