GNB1 Antibody

Images

 
Western Blot: GNB1 Antibody [NBP1-55307] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Mu, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: beta-1.
Predicted Species
Mouse (100%), Zebrafish (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%), Equine (100%), Canine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GNB1 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
GNB1 Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 3
using
NBP1-55307 in the following application:

Publications
Read Publication using
NBP1-55307 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26149443).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNB1 Antibody

  • beta subunit, signal-transducing proteins GS/GI
  • G protein, beta-1 subunit
  • guanine nucleotide binding protein (G protein), beta polypeptide 1
  • guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1
  • guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  • Transducin beta chain 1

Background

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a bet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-45552
Species: Hu
Applications: WB, IHC
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
AF2945
Species: Hu
Applications: WB
H00002268-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-52107
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P

Publications for GNB1 Antibody (NBP1-55307)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Review for GNB1 Antibody (NBP1-55307) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-55307:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GNB1 NBP1-55307
Enlarge
3
reviewed by:
Anonymous
WB Human 09/06/2017
View

Summary

ApplicationWestern Blot
Sample TestedNeutrophilic cells whole cell lysate
SpeciesHuman
LotQC23500-100506

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNB1 Antibody (NBP1-55307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GNB1 Products

Bioinformatics Tool for GNB1 Antibody (NBP1-55307)

Discover related pathways, diseases and genes to GNB1 Antibody (NBP1-55307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNB1 Antibody (NBP1-55307)

Discover more about diseases related to GNB1 Antibody (NBP1-55307).
 

Pathways for GNB1 Antibody (NBP1-55307)

View related products by pathway.

PTMs for GNB1 Antibody (NBP1-55307)

Learn more about PTMs related to GNB1 Antibody (NBP1-55307).

Blogs on GNB1

There are no specific blogs for GNB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
09/06/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol GNB1
Uniprot