GNAQ Antibody


Western Blot: GNAQ Antibody [NBP1-58311] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB

Order Details

GNAQ Antibody Summary

Synthetic peptides corresponding to GNAQ(guanine nucleotide binding protein (G protein), q polypeptide) The peptide sequence was selected from the N terminal of GNAQ. Peptide sequence DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK.
This product is specific to Subunit or Isoform: alpha.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GNAQ and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNAQ Antibody

  • guanine nucleotide binding protein (G protein), q polypeptide
  • Guanine nucleotide-binding protein alpha-q
  • guanine nucleotide-binding protein G(q) subunit alpha


Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Ca, Eq, Gt, GP, Rb, Sh, Ze
Applications: WB
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC

Publications for GNAQ Antibody (NBP1-58311) (0)

There are no publications for GNAQ Antibody (NBP1-58311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNAQ Antibody (NBP1-58311) (0)

There are no reviews for GNAQ Antibody (NBP1-58311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNAQ Antibody (NBP1-58311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GNAQ Products

Bioinformatics Tool for GNAQ Antibody (NBP1-58311)

Discover related pathways, diseases and genes to GNAQ Antibody (NBP1-58311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNAQ Antibody (NBP1-58311)

Discover more about diseases related to GNAQ Antibody (NBP1-58311).

Pathways for GNAQ Antibody (NBP1-58311)

View related products by pathway.

PTMs for GNAQ Antibody (NBP1-58311)

Learn more about PTMs related to GNAQ Antibody (NBP1-58311).

Blogs on GNAQ

There are no specific blogs for GNAQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GNAQ Antibody and receive a gift card or discount.


Gene Symbol GNAQ