Recombinant Human GM2A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GM2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human GM2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Protein/Peptide Type
Recombinant Protein
Gene
GM2A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GM2A Protein

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
8907-GH
Species: Hu
MAB6237
Species: Hu
Applications: WB, IHC
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56700
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-47446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
H00002760-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GM2A Recombinant Protein (H00002760-P01) (0)

There are no publications for GM2A Recombinant Protein (H00002760-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Recombinant Protein (H00002760-P01) (0)

There are no reviews for GM2A Recombinant Protein (H00002760-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM2A Recombinant Protein (H00002760-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GM2A Products

Bioinformatics Tool for GM2A Recombinant Protein (H00002760-P01)

Discover related pathways, diseases and genes to GM2A Recombinant Protein (H00002760-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM2A Recombinant Protein (H00002760-P01)

Discover more about diseases related to GM2A Recombinant Protein (H00002760-P01).
 

Pathways for GM2A Recombinant Protein (H00002760-P01)

View related products by pathway.

PTMs for GM2A Recombinant Protein (H00002760-P01)

Learn more about PTMs related to GM2A Recombinant Protein (H00002760-P01).

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MD-1/LY86 Antibody
NB100-56700
GM2A Antibody
NBP1-87090

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GM2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GM2A